SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028416 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028416
Domain Number 1 Region: 133-219
Classification Level Classification E-value
Superfamily DEATH domain 3.83e-18
Family DEATH domain, DD 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028416   Gene: ENSRNOG00000020936   Transcript: ENSRNOT00000028416
Sequence length 228
Comment pep:known chromosome:Rnor_5.0:8:118231775:118234748:-1 gene:ENSRNOG00000020936 transcript:ENSRNOT00000028416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHNVSKGVVYSDTALKGQDGDREGMWVGAGGALAPNTSSLFPPEPPGASSNIIPVYCAL
LATVVLGLLAYVAFKCWRSRKQRQQLAKARTVELGDPDRDQRHGDSSVFVDSPHGLEPCI
PSQGPHADLGCRLYLHIPQQQQEEVQRLLILGEPAKGWQGLAGQLGYQAEAVETMACDQD
PAYALLRDWAAQEGSGATLRVLEDALTAIGREDVVQVLSSPAEGCSVV
Download sequence
Identical sequences Q8K5A9
ENSRNOP00000028416 ENSRNOP00000028416 10116.ENSRNOP00000028416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]