SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028887 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028887
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 1.83e-47
Family DNA polymerase processivity factor 0.000000375
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 4.28e-42
Family DNA polymerase processivity factor 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028887   Gene: ENSRNOG00000021264   Transcript: ENSRNOT00000028887
Sequence length 261
Comment pep:known chromosome:Rnor_5.0:3:131376228:131380189:-1 gene:ENSRNOG00000021264 transcript:ENSRNOT00000028887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLIQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVSIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences P04961
10116.ENSRNOP00000028887 ENSRNOP00000028887 NP_071776.1.100692 NP_071776.1.4139 ENSRNOP00000028887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]