SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029738 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029738
Domain Number 1 Region: 1322-1397
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-16
Family I set domains 0.0099
Further Details:      
 
Domain Number 2 Region: 936-1009
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000027
Family I set domains 0.069
Further Details:      
 
Domain Number 3 Region: 719-772
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000497
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 431-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 583-637
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000105
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 486-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1221-1298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000367
Family I set domains 0.066
Further Details:      
 
Domain Number 8 Region: 87-135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 773-832
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 829-893
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 1498-1557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 1615-1669
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 1439-1496
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000116
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 353-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 661-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029738   Gene: ENSRNOG00000010840   Transcript: ENSRNOT00000032106
Sequence length 1705
Comment pep:known chromosome:Rnor_5.0:1:145170122:145490043:1 gene:ENSRNOG00000010840 transcript:ENSRNOT00000032106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRETPRILDPMAFWTGSWWLLTRMIFTVSGLLQATAEKSPGAYFLPEFALSPQGSFLE
DTTGEQFLTYRYDDQTSRNAHSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNC
EGQNIRYKTCSNHDCPADAEDFRAQQCSAYNDVQYQGHYYEWIPLHNDPAAPCALKCHAR
GQSLVVELAPKVLDGTRCNADTLDMCISGICQTVGCDRQLGSSAKKDNCGVCAGDGSTCR
LVRGQTKVHLSPEKKEENVIAVPLGSRSVRITVKGPALLFIESKTLQGSRGEHSFNSPGV
FVVENTTIEFQKGADRQTFKIAGPLMADFIFKTRYTVAKGSVVQFFFYQPISHQWRQTDF
FPCTVTCGGGYQLNSAECMDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFK
EIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKCMYAPKP
KVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQMKLHIKEEC
VIPVPCYKPKEKSPVEAKLPWLKQAQELEETRIATEEPKFIPEPWSACSTTCGPGIQVRE
VRCRVLLTFTQTETELPEEECEGPKPPTERPCLLEACDHSPVSRELGGPLQEKDSEMIYD
WEYAGFTPCTATCLGGYQEAIAVCLHIQTHQTVNDSLCDLAHRPPPMSQACHTEPCPPRW
HMGSWGACSATCGVGIQTRDVYCVHPEESPAPPEECRDEKPHALRACNQFDCPPSWHIEE
WQQCPRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPQLAAGD
WSKCSVTCGVGFQRRKQVCQKLTAKGRRVPLAETLCRDLPGLPLVRPCQMPVCSKLKLGM
KTNLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRHFQKSLIQWE
KDGHCLKNSKQLGITKSGSLKIHSLSTPDIGVYRCIAGSAQETVVLKLIGTDNRLIAHPS
LREHARAYPGLDHNEANSLGATWHKMRQLWNSKNDLYLHGGEINKQPFLRALFGPCRTSE
GNDNSWEFKSKQFEAAMKQGAYSMDTAQFDELIRNMSQLMETGEASDDLASQMIYQLVAE
LAKAQPVQWRGTHEEVVASEAQFRGETGRVPKSPTVKNPGKLTFKPKGPVLMRQTLPPSV
SFNKTINARIGNTVYITKSTEVINILCSLVTPSSEATYTWTKDGALLQPSVKIIVDETGK
MQIQNPTRKEQGIYECSVASHQGSDVESSLVLYAEAPVILSIERNVTKPEHNHLSVVVGG
IVEAALQANVTIHCPVKGVPQPNVTWLKRGGSLSDNVSLLFNGSLLLQNASLENEGTYIC
TATNALGKAVATSGLRLLERREPGNKTAFPKAQKKRVLQASKNRANSNNSTGKSLPQEYF
WEPGNWTHCSATCGPLGVRLQRPQCMMASGQEVSEALCGPHRKPLAGFQSCNIRDCPARW
FTSMWSECSVSCGGGSHSRQVMCKQTKANGTVQVVSPRACASKDRPLGRKPCSVRPCAQQ
ATDLGSQCPGRCMGQAMRMQHHHTPCAHNSSNSDCEDRRRLAFRRNCTSGPCEACWRVGP
WKPCTAVCGRGFQSRKVNCIHTGSCKPMADRYCVQMKPASWRHCFGPSCDRNCIDTTHYC
MFVKHLNLCSLALYKQRCCQSCQER
Download sequence
Identical sequences NP_001101003.2.100692 NP_001101003.2.4139 ENSRNOP00000029738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]