SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031123 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031123
Domain Number 1 Region: 244-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-45
Family Nuclear receptor ligand-binding domain 0.00000695
Further Details:      
 
Domain Number 2 Region: 119-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.15e-27
Family Nuclear receptor 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031123   Gene: ENSRNOG00000023073   Transcript: ENSRNOT00000036229
Sequence length 504
Comment pep:known_by_projection chromosome:Rnor_5.0:2:224862584:224881587:-1 gene:ENSRNOG00000023073 transcript:ENSRNOT00000036229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANTYVTTSDGYYLAEPTQYYDILPEQLHYQLCDTDFQEPPYSQYSTAQFPPALQSPSLQ
SHFSTYGLEPQYSGGSWCGLDTRESSQSTYVVVHDDEDEFPGTQRCRPTCSLRWKGQDEL
CMVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYSCKNGGHCEMDMYMRRKCPECRLKK
CKAVGMLAECLLTEIQCKSKRLRKSFKHRPTLSSAIQVEDEGTDTKHVSSTSRSGKGAQD
DMTLTAEERRLLNTIVTAHRKSMVPVGEISALLQEYSNPELSFLRLSEASILHANWLMKF
TKGLPGFENLTAEDQTALQKESKTEVMFLHVAQLYGGRDSTSGSTVRPAKPSAGTLEVHN
HRGDECVYSSENFFKEGYPSATLTGITREFIASLSYFYRRMRELNITDTEYALLTATTVL
FSDRPYLKNKQHVENLQEPVLQLLFKYSKMYHPEDPQHFAHLIGRLTELRTLSHSHSEIL
STWKTKDPRLVMLFSEKWDLHSLY
Download sequence
Identical sequences D3ZFA7
ENSRNOP00000031123 XP_003749414.1.100692 XP_003753694.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]