SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033496 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033496
Domain Number 1 Region: 190-423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.21e-58
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 37-151
Classification Level Classification E-value
Superfamily POZ domain 2.17e-23
Family Tetramerization domain of potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033496   Gene: ENSRNOG00000024310   Transcript: ENSRNOT00000033327
Sequence length 505
Comment pep:known chromosome:Rnor_5.0:6:52191821:52193338:-1 gene:ENSRNOG00000024310 transcript:ENSRNOT00000033327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGLASEPTRSMDASAEQSLPEPGSQDSVAGDDIEIVVNVGGVRQVLYGDLLSQYPETR
LAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPIC
FKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCV
WKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVVDSEGNRVEHPTLENVETA
CIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQA
VQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQS
HPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINN
FVRYYNKQRVLETAAKHELELMELNSSSAESKPGGSRSDLDTLPPEPAAREGPSWGSRLK
LSHSDTFIPLLTEEKHHRTRLQSCK
Download sequence
Identical sequences D4ADX7
ENSRNOP00000033496 NP_001162575.1.100692 NP_001162575.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]