SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034797 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034797
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-32
Family C-type lectin domain 0.00000159
Further Details:      
 
Domain Number 2 Region: 241-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 303-377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 180-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 360-427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 425-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034797   Gene: ENSRNOG00000002723   Transcript: ENSRNOT00000030677
Sequence length 549
Comment pep:known chromosome:Rnor_5.0:13:87235309:87242177:1 gene:ENSRNOG00000002723 transcript:ENSRNOT00000030677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASCFLSALTFVLLIGKSIAWYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLN
STLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPK
DSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTC
QEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHV
VECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSC
KAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQI
PVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWD
SEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSA
MLPTCEAPANPPRPLVVALSVAATSLLTLSSLIYVLKRFFWKKAKKFVPASSCQSLQSFE
NYQGPSYII
Download sequence
Identical sequences P98105
NP_620234.1.100692 NP_620234.1.4139 ENSRNOP00000034797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]