SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037964 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037964
Domain Number 1 Region: 11-226
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-47
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 256-446
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.42e-33
Family BAR domain 0.014
Further Details:      
 
Domain Number 3 Region: 592-673
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-20
Family SH3-domain 0.00049
Further Details:      
 
Domain Number 4 Region: 494-573
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037964   Gene: ENSRNOG00000025502   Transcript: ENSRNOT00000032189
Sequence length 676
Comment pep:known chromosome:Rnor_5.0:18:56048375:56099677:-1 gene:ENSRNOG00000025502 transcript:ENSRNOT00000032189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFETDEASSKSESPEQEGQGSEDKSLLHQRLAIRELIDTEVSYLHTLRLCTSDIRGHL
QQLPPGDLDILFSNIDDIIQVSSRFLHGLQETACKEEKQAHLIGNLFLEFQEELEQVYKV
YCANYDQALLLVKAYQKEPELQKEIQGIIEAAVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTPADASAHPVLQRATSALQDVNSNINEYKMRKEVALKYTKVEQLSLRERLARINT
HTLSKKTTRLSQLLKQEAGLVPRTEDKEFDDLEERFQWVSLCVTELKSNVAAYMDNLEAF
LCFRPHERNLDIPGGAAEQYCSLARDLQLQAFLQFKQRLTGLVWQPLCSLARALVGPQNL
IKKRLDKLLDFERVEEKLLDVGSVTYEEEAARHTYQALNSLIVAELPQFNHLVMQWLGQI
LRTFVVLQRDLADQVLRRAESSMALLPHRHVSEPDFQKLLEDTLGQSSSQLRHFRESFEK
VLPPSTSQPLLPGSEHQMQSLLTRYGPGKIYQVTSNINGTGTLDLTLPRGQIVALLQNKD
TKGNNSRWLVDTGGHRGYVPAGKLQLYHPINPSEKEPRRQTGMPEDYWLPTPEPTQPSVP
TVPTMSQVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYVPSNF
LARTPSPTPWGWNLPS
Download sequence
Identical sequences F1LQ74
ENSRNOP00000037964 10116.ENSRNOP00000037964 ENSRNOP00000037964 XP_006254869.1.100692 XP_006254870.1.100692 XP_006254871.1.100692 XP_006254873.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]