SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038097 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038097
Domain Number 1 Region: 568-677
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 391-502
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-18
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 684-749
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000127
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 221-329
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000301
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 5 Region: 811-870
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000695
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 743-805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 332-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 507-571
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000823
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038097   Gene: ENSRNOG00000025612   Transcript: ENSRNOT00000032193
Sequence length 962
Comment pep:known chromosome:Rnor_5.0:12:51848836:51998895:1 gene:ENSRNOG00000025612 transcript:ENSRNOT00000032193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVAPPQAAGPDRISLLLVALLLGSPVAARAEDGGPEGDMHPSTAYLLPSALLEGSLEEG
VTSAAPGPLPSREALEALEGSLPPLFPDEARVQHTPSLRKALPSLKQLNSARRQLRPLAT
PTTLQRLGSPSSATTKPREPGDPEQPTAPAPLQIAPFTALATTLPHSPQPAQAPDDSSLS
SPLDKGDNELTGSASEESQETTTSTIVTTTIITTEQAPALCGVSFSDPEGYIDSSDFPPQ
PSSSFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPTLTVLANQTLLVEGQVI
RSPTNTISVYFRTFQDDNLGTFQLHYQAFMLSCNFPRRPDAGDVTVMDLHSGGVAHFHCH
LGYELQGAKTLTCINASKPHWSSQEPVCSAPCGGAVHNATIGRVLSPSYPGNTNGSQLCV
WTIEAPEGQKLHLHLERLLLHEKDRMVVYSGRTNTSALLYDSLRTESVPFEGLLSEGSNI
RIEFTSDQGQAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSL
EQGPAVIECVNVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYAEGEDCVWKIHV
GEEKRIFLDIHLNLSNSDILTIYDGDEVVPHVLGQYFGNSSPQKLYSSTPDLTIQFHSDP
AGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVG
SDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVEHSTRLISDPVLLVGTTIQYTCSPGFVLE
GSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMC
YEGFELMGEVTIRCILGQPSHWSGPLPICKVNQDSFEHALEAEAAAESSLEGGNMALAIF
IPVLLISLLLGGAYIYVTRCRQYSSLRLPLMYSHPYSQITVETEFDNPIYETGETREYEV
SI
Download sequence
Identical sequences NP_001128010.1.100692 NP_001128010.1.4139 ENSRNOP00000038097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]