SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039183 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039183
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.67e-21
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000513
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 5-71,422-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000816
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000039183
Domain Number - Region: 142-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000575
Family Intermediate filament protein, coiled coil region 0.0078
Further Details:      
 
Domain Number - Region: 223-336
Classification Level Classification E-value
Superfamily Prefoldin 0.0011
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039183   Gene: ENSRNOG00000008367   Transcript: ENSRNOT00000045495
Sequence length 486
Comment pep:known chromosome:Rnor_5.0:7:140922818:140929091:1 gene:ENSRNOG00000008367 transcript:ENSRNOT00000045495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGSYCGGRAFSCASACGPRPGRCCITAAPYRGISCYRGLSGGFGSHSVCGAFRSGSCG
RSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSRFAAF
IDKVRFLEQQNKLLETKWQFFQNRKCCESNVEPLFEGYIETLRREAECVEADSGRLAAEL
NHAQEAMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANTEALTQEIDFLR
RLYEEETRILHAHISDTSVIVKMDNSRDLNMDCVIAEIKAQYDDIASRSRAEAESWYRTK
CEEIKATVIRHGETLRRTREEINELNRIIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAA
LTDARCKLAELEAALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCVSGTAPAVNTRVCSAPCSGNVVVGTPNACGPCAGAGACS
GGCKKC
Download sequence
Identical sequences A0A0G2K126
XP_017450523.1.100692 ENSRNOP00000039183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]