SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042077 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042077
Domain Number 1 Region: 49-485
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-103
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000042077
Domain Number - Region: 567-684
Classification Level Classification E-value
Superfamily Clc chloride channel 0.00471
Family Clc chloride channel 0.021
Further Details:      
 
Domain Number - Region: 508-557
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00918
Family TNF receptor-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042077   Gene: ENSRNOG00000033073   Transcript: ENSRNOT00000044004
Sequence length 850
Comment pep:known chromosome:Rnor_5.0:14:1106281:1113140:1 gene:ENSRNOG00000033073 transcript:ENSRNOT00000044004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKELCTFTISFLLLKFSFIMWGLTEPSCFWRIKNNGDNDGDLRTDCGFVLFTRQEPIEEN
FYNEIVYFRIPARSYEFFLVMFFATDEINKNPYLLPNMSLIFSLIVGMCEDTLEYVDTNY
SFKRNTLNIVNYNCYLRARCYIQLTGPSWKTSLKLTINSRKPKVFFGPFNPNLSDRDQFP
YVNQIARKDTFLSHAMISLMLFFEWTWIGLAISDDDQGIQFLSVTREVMQKHSICSAFVN
VIPENMQIYMARANIYDKQIMTSSAKVVIIYGERNSTLEVSFRRWEYLGAQKIWITTSQW
DVITNKRVFSLDFFHGTVTFAYHNGRIPKFRNFMQTMNTSKYPVDISQTILEWNYFNCSI
FKNSDSEMNHFTSKNTEEWLAQHKFDMVLSEEGYNLYNAVYAVAHTYHELILQEVESQKI
LRHKGRFINCQQVASLLKTRIFMNPVGELVNMNQRENQCAEYDIFNIWNFPQGLGLKVKI
GSYFSCFPQSQQLQISEDLKWATGGTSVPTSMCSVTCTAGFRKIHQNEAAHCCFDCALCP
ENEVSNDTADMEQCVRCPDDKYANLEQTYCIQRHVSFLAYEEPLGLTLGCMALCFSALTI
LVLVTFVKHKNIPVVKANNCILSYILLISLIFCFLCSLLFIGHPKKTTCILQQITFGIFF
TMAISTVLAKTITVVMAFKLTTPGRRMRRILASGAPNLIIPICTLIQLVICGTWLATSPP
FIDRDIQSEHGKVIIICNKGSVTAFHFVLGYLRSLALGSFAVAFLARNLPDRFNETKFLT
FSMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCVFIPKCYVILVRPNSNF
LQKYKNKLLY
Download sequence
Identical sequences D4A754
NP_001092951.1.100692 NP_001092951.1.4139 10116.ENSRNOP00000042077 ENSRNOP00000042077 ENSRNOP00000042077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]