SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044230 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044230
Domain Number 1 Region: 51-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-105
Family L-arabinose binding protein-like 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000044230
Domain Number - Region: 513-563
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00377
Family TNF receptor-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044230   Gene: ENSRNOG00000040210   Transcript: ENSRNOT00000039900
Sequence length 849
Comment pep:known chromosome:Rnor_5.0:14:1006116:1019603:1 gene:ENSRNOG00000040210 transcript:ENSRNOT00000039900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLCAFTVSFLFLKFSLILCSFTELSCFWRMKNSEDSDGDLRSDCGFVLLTTKKNIEDF
YNDINEVRIPARRYEFFLVMFFATDEINNNPYLLPNISLIFSIIAGLCEDTLGVLDEIYS
QQNNSWNIVNYICEKGQRCDIELTGPSWKASVKLSIHSMIPSVRMCDTGCVFFGPFNPNL
SDHDQFPYMYQIATKDTCLSHGMVSLILHFRWNWLGLVISDDDQGIQFLSDLREEMQSHG
ICLAFVNMIPETMQVYMIKAKIYDKQIMTSSAKVVIIYGEMNSTLEVSFRRWSYLGVQRI
WITTSQWDVITIKKDFNLDFFHGTLTFAHHKVEVAKFRNFMQTRNPAKYPVKFFESVLGW
NYFNCSISKNSNLMDHFIFNNTLEWIALNKYDMVLSEEGYNLYNAVYAVAHTYHELILQQ
TESQNIAEPNGVFIDCQQVASLLKTRVFTNPVGELVNMKHREKQCVEYDIFITWNFPEGL
GLKVKIGSYFPCFPQSQQLHISEDLEWATGGTSVPSSMCSATCTAGFRKIHQKQTADCCF
DCVQCPENEVSNETADMEQCVRCPDDMYANLEQTQCLQRTVSFLAYDDPLGIALGCMALS
FSAITILVLVTFVKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQATCILQQT
TFGVFFTVAISTVLAKTITVVMAFKLTTPGRRLRGMMITWASNFVIPFCTLIQLVLCGIW
LVTSPPFIDRDIQSEHGKTIIICNKGSVIAFHVVLGYLGSLALGSFTIAFLARNLPDRFN
EAKFLTFSMLVFYSVWITFLPVYHSTRGKVMVVVEVFSILASSADLLGCIFVQKCYIILV
SSNSNFLHK
Download sequence
Identical sequences D3ZXT3
NP_001092938.1.100692 NP_001092938.1.4139 10116.ENSRNOP00000044230 ENSRNOP00000044230 ENSRNOP00000044230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]