SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044305 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044305
Domain Number 1 Region: 245-345
Classification Level Classification E-value
Superfamily HMG-box 5.89e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 518-616
Classification Level Classification E-value
Superfamily HMG-box 2.49e-22
Family HMG-box 0.00000362
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.36e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 354-432
Classification Level Classification E-value
Superfamily HMG-box 5.37e-17
Family HMG-box 0.00000922
Further Details:      
 
Domain Number 5 Region: 443-522
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000044305
Domain Number - Region: 643-660
Classification Level Classification E-value
Superfamily ARM repeat 0.0173
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044305   Gene: ENSRNOG00000020937   Transcript: ENSRNOT00000048418
Sequence length 727
Comment pep:known chromosome:Rnor_5.0:10:90038146:90051350:-1 gene:ENSRNOG00000020937 transcript:ENSRNOT00000048418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEIMRDYIQKHPELNISEEGI
TKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQ
KEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQ
EGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK
AREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQK
FSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSL
SPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEDDDDDDEEEEEDD
ENGDSSEDGGDSSESSSEDESEDGDENEDDDDDEDDDEDDDEDEDNESEGSSSSSSSSGD
SSDSDSN
Download sequence
Identical sequences NP_001099193.2.100692 NP_001099193.2.4139 XP_008766174.1.100692 ENSRNOP00000044305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]