SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044812 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044812
Domain Number 1 Region: 29-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-34
Family Spermadhesin, CUB domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 189-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0000198
Further Details:      
 
Domain Number 3 Region: 305-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 139-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000339
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044812   Gene: ENSRNOG00000001827   Transcript: ENSRNOT00000047678
Sequence length 385
Comment pep:known chromosome:Rnor_5.0:11:79959899:79998571:-1 gene:ENSRNOG00000001827 transcript:ENSRNOT00000047678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLSFRRLLLYHVLCLTLTEVSAHTVELNEMFGQIQSPGYPDSYPSDSEVTWNITVPEG
FRVQLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMS
VTFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILH
TDNRTCRVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIE
DHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYR
AAGNECPKLQPPVYGKIEPSQAVYSFKDQVLISCDTGYKVLKDNEVMDTFQIECLKDGAW
SNKIPTCKKSEIDLEEELESEQVAE
Download sequence
Identical sequences XP_008767026.1.100692 ENSRNOP00000044812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]