SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045942 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045942
Domain Number 1 Region: 737-983
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-54
Family Nuclear receptor ligand-binding domain 0.0000004
Further Details:      
 
Domain Number 2 Region: 601-683
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-24
Family Nuclear receptor 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045942   Gene: ENSRNOG00000034007   Transcript: ENSRNOT00000052018
Sequence length 985
Comment pep:known chromosome:Rnor_5.0:19:45289894:45639834:-1 gene:ENSRNOG00000034007 transcript:ENSRNOT00000052018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTTENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPCIQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPTKIYQNMEQLVKFYKENGHRSSTLSAMSRPLRSFMPDSAASMNGGALRAI
VKSPIICHEKSSSVSSPLNMASSVCSPVGINSMSSSTTSFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPTHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNNTNNRSTLSSPTASTVGSIGSPISNAFSYATSGASAGAGAIQDVV
PSPDTHEKGAHDVPFPKTEEVEKAISNGVTGPLNIVQYIKSEPDGAFSSSCLGGNSKISP
SSPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPG
FDGSCEGSAFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSP
RDQSFQHLSSFPPVNTLVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRP
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRKNC
PACRLQKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSV
NSALVPQLTSITHALTPSPAMILENIEPETVYAGYDNSKPDTAESLLSTLNRLAGKQMIQ
VVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQLLYFAPDLVFNEEK
MHQSAMYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVCPKEVLGDRPVEEVRNVY
IKSLWRSLRRCWQSMPQTWSPFCAGQLLLKSLEELVSDLLEFCFYTFRESQALKVEFPAM
LVEIITDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences ENSRNOP00000045942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]