SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049006 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049006
Domain Number 1 Region: 3933-3978
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000183
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 2348-2489
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000414
Family Extended AAA-ATPase domain 0.066
Further Details:      
 
Domain Number 3 Region: 2706-2919
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000614
Family ABC transporter ATPase domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049006   Gene: ENSRNOG00000029658   Transcript: ENSRNOT00000044983
Sequence length 5137
Comment pep:known_by_projection chromosome:Rnor_5.0:10:108134733:108229040:1 gene:ENSRNOG00000029658 transcript:ENSRNOT00000044983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCPQCGHVSSEKAAKFCSQCGQKLSPAATEQADLKNNNALVEASTTEGKTEPGEVLREE
VVLLSSTDSGKELQNPEESESDASWTTHVSKKEKRRRRRQGTISSSEAASMSSGLWSLDL
PSGPGSHNSALPQNQAQQGGTANQPGHSLDTVKMPVEKDGSACVEGSGSSLRGPVAEGPE
DAQRNPAASDYVEVKDLKTSNPSVDKGPKMTDASQKASLPESKGEQPGHGEKVPPIDTAA
NPVKRARKETRDDVQKQKPSPVSLATSKDRDQKAELESKLATPVRKSDESRNTQPEDQKK
PGGDRNYAAAAKNKNQQAAALEATKRHDPGDRVTVCFHAIVSRDFGFNPDKHRAYVRGGE
GLGQKGWTDACEMYYTQDLHDLGSLIEGKMDIPRQSLDKPIPYKYVIHHGSSSKDSVEYE
FIYEQPQKKGEHVNRCLQVDSTLLSSGDWHQYDDIIWMRSPGLLQQAKNYITDGTRKNLV
RGKKQAAVIMLDRIFSVLQSWSAINLQTFMTQFRQFYSVVRVPMIHDGHARKWSSLQYEE
REVRLNLWEHVKKLMMPFLEGKSGESLPADCPVRSKQILGLSILCMVEAADFTVPKKDLD
SLCYLLIPSADSPEALHRDLSPVLSIRQRWHAYLITLCFRCIEVGCDRWLGILPLLHYCM
QQSPPRKNSKSQTEDVWAGLEGISFSEFRDKASARSQALQLMQNRMALLHVDEYLFRSWF
SLVPLESLSSYLENSEEYLSHMPTRVLDCFQGISYRLRGLGKISKQNIEAKDVKKVFKIL
MYLVDMYQDRIFEESLPQIYLTECADLHETVCSITADRQFYQTPALSAELVCAVLQLSPP
EHTEEGLVAKSYEDLVRTTFQEALNTTRKWLRTVFKSPMLSRNFAAVQLSYPDEMAVWRR
LVGINFPEKYGWKGPLLGDMEGRLKQESPRLQISFFCSSHCCDEGPHDSVARSIEKCVIE
AVSSVCQSQTSVLEGLSCQDLQKFGTLLSAVITKSWPVHNGELVSDVDEIFKYLLKWPDV
RQLFKLCGTNENITNHITKEGRRLMVTAESVFQKVAGELENGTIVVGQLELILKYKSQFL
GIWDINSLSLLRRERGRELGHTMLRTGDGMFLGRAEKLNLRSIMREHHRLAEVSIVELGN
IERIHSQDLSNKKLNEAVIKPPNSSFSNRKTHYYLSPDILEMASKLDSLKDSHVFQDFWH
ETAELLSNDTLDQDRRELKLSLPDVVDHLYYPCYEKFYKLYMNLRSGEITFADVDVIFRD
FKDKYDELNVDLKFMCTLDPQDRKGWISQRVRQIKEYHTLYQAVSSAKVIVQVRRALGVT
GDFSVLNPLLNFADDFEDFRNEKLNQISPQFIKAKELLQDISELRHRCLEELALQTELVH
WLHEALKDINELKVFVDLASISAGENDIDVDRVACFHDAVQGYASLLYKLGANTDFNEFM
NHLQELWRALDNDQHLPDKLKDSARNLEWLKTVKESHGSVELSSLSLATAINSRGIYIIQ
APKDGQKVSPDTVLHLLLPDDHGYQEAFRKYSTEELKELLNKLMLMSGRKDHSSNVEVET
FSEVFSNMQRLVHVFINLHCAGNMLFRTWTAKVYCCPGGGISMDFGSKLLNQLTESGDVI
QLLGALCRQMEDFLHEWKTVVAQKRATHFYLNLYTAEQLVYLSSELRKPRPSEAALMMLS
FIKGKCTVQELIQATSACENKAARHCLQEAMRKLPQQLLSESTLMGKLRVIMTQSLECMS
AFLPSCLDLDTLGRCLAHLARLGGSPVERPLPKGLQVGQPNLILCGHSEVLSAALAIYMQ
DPMQPLPTFDEVLLCTPGTTIEEVELFLRRCLTLDSQEHKVYSLLFADQLSYEVGCQAEE
LFQSLSTQVHREDYQLVILCDAAREHCYIPSTFSQHKVPLVPQAPLPDIQAYLENHYQVP
KQIQSAATVFRDGLCVGIVTSERAGVGKSLYVNTLHKKLKTKLQDETVPLKIIRLTEPHI
DENHVLSALLPFLEKNYQKTPVIFHIDVSTSVQTGIPVFLFKLLILQYLMDINGKMWRRN
PCHLYVVEIPQAHSVRPKRSSKLNARAPLFKFLDIFPKVTCRPPKEVINMELTPKRSHIE
PGMDPAEFCSEAFQRPYQYLRRFHQGQNLDAFRYEKDSVEGSPEECLQHFLIYCGLTNPS
WSELRNFAWFLNCQLKDCEASVFCNSAFTGDTLRGFKNFVVTFMVLMARDFATPTLQTSD
QSPGKHSATIDGVAEEDLAPFSLRKRWESEPHPYVFFNGDRMTMTFIGFHLKTNSNGYVD
AINPSSGNIIKKDVMTKELFDGLKLQRVPFNINFDSLPRHEKLERLCLALGIEWPSDPDE
TYELTTDNMLKILAIEMRFRCGIPVIIMGETGCGKTRLIKFLSDLRRGSIEAETMKLVKV
HGGTTPSMIYSRVKDAERTAFFNKAQHNLETILFFDEANTTDAVSCIKEVLCDRTVGGEH
LNEDSGLHVIAACNPYRKHSQEMIHRLESAGLGYRVGAEETADRLGSIPLRQLVYRVHAL
PPSLIPLVWDFGQLNDSAERLYIQQIVQRLVDSVTVDQRETFVIANVLSASQEFMRKREN
ECGFVSLRDVERCVKVFQWFHDHSNMLLNKLADFLRECCDSTPAFERDPVLWSLVMAIGV
CYHASLEEKAPYRAAIARCLPKPYNSPKVILNEITHVQDLFLRDAPIRSNIARNLALKEN
VFMMVICIELKIPLFLVGKPGSSKSLAKIIVADAMQGQAASSDLFRCLKQVHLVSFQCSP
HSTPQGIISTFKQCARFQQGKDLQQYVSVVVLDEVGLAEDSPKMPLKTLHPLLEDGCIED
DPAPYKQVGFVGISNWALDPAKMNRGIFVSRGSPNEKELIESAEGICSSDRLVQDRIRGY
FAPFAKAYETVCQKQDKEFFGLRDYYSLIKMVFAKAKASKKGLSPRDIAHAVLRNFSGKD
DIQALSIFTASLPETLYKEEVSTVELIKQNIHPDLQGSSRGLDSADSRYLLVLTRNYVAL
QILQQTFFEGQQPEIIFGSSFPQDQEYTQICRNINRVKVCMETGKMVVLLNLQNLYESLY
DALNQYYVYLGGQKYVDLGLGTHRVKCRVHTDFRLIVIEEKDVVYKQFPVPLINRLEKHY
LDMNTVLQGWQKGIVQELQRWAHEFADVKADQFIARHKYSPADVFIGYHSHACASVVLQA
VERQGCRNLTEELYRKVFEEAKFILLDCATPDAVVRLSGSSLGSFAANRLSQEYYYKQQH
NSFVDFLLAHLRMDHHECWAVFTEITTFSRLLTSHDCDVLESELRGLAPKPIVLSLQQFD
TEYSFLKDVRSCLRNPARRKILVIQTDFDDGIHSAQLVASAKYSAINEINKTQGTEDFVF
VYFVTKLSRMGSGTPYVGFHGGLWRSVHIDDLRRSTVMASDVTKLQNVTISQLFEPVDKP
EQEEMETESSKSGEVAEEQMEVEEEGSEEMKRACDLRGCDCSQVLDTTRLVRSCVQGAVG
MLRDQSESCARNMRRVTILLDLLNEESTLNASFLRESKMRLHVLLNKQEENQVRSLKEWV
TREAANQDALQEAGTFRHTLWKRVQDVVTPILASMISHIDRDGNLELLARPGSPAWAQDL
WMFIYSDIKFLNIPLALNNTRSNSEMPFILVQSHMNLLKDACNAVPFSWRIRDYLEELWV
QAQYITDTEGLSKKFVEIFQKTPLGLYLAQFPTAQQQELLQSYLKDFLLLTMKVSSREEL
MFLQMALRSCLSELQVASGTPEEGLSLPWVHLAYQHFRTRLQNFSRILTIHPQVLSSLSQ
AAEKHNLAGCEMTLDAFAAMACAEILKGDILKPSPRVWLQLVKNLSMPLELVCSEGYLQD
SGSMTRAIIQEVRALWNRIFSIALFVEHVLLGTESQIPELSPLVTKYVSLLDKCLEEDSN
LKTYRPFAAVMTTLCNCKDKASKKFCRFGIQPCSICQGDAQDPVCLPCDHVYCLPCIQTW
LAPGQMICPYCKTELPDKFSPTVSQNHRKAIEKHAQFRHMCNSFFVDLVSTMCFKDNIPP
QKSVIDTLLSLLFVQKELLRDASQRHREHTKSLSPFDDVVDKTPVIRSVVLKLLLKYSFH
EVKGYIQNYLSQLENKAFLTEDKTELYLLFINCLEDSVYQKTSAGCRNHERVLREEGHFL
RTYSPGLRGSEPVRTASVEYLQEMARVRLCLDLAADFLSELQEGSELAEDKRCFLKHVEQ
FCTRVNNDWHRVYLVRKLSSQRGMEFVQSFSRQGHPYQWVFPREVLAQQVRSRDHLSQLD
RYLVHGDEYKAVRDAMAKAVLDCKTLDVGNALSTCRSPKDQQTAYLLLALYTEVTALYRS
RNGSLHPDSKQLEAMNKFINESKILSAPKINRFAKSLVANTLPLLQTRSANGSLRVTVTE
MAIHVATILLCGQDKVLEPLRNLAFYPFKMVNAFLPTMPEDLLVHAKFWEGLTNVRWYTC
PNGHPCSVGECGQPMEMSICPDCRVPIGGLNHKPSVGFDVIRNNEDRTQTGHVLGNPQSS
GTAEASDRGQSPVVFILTRLLTHLAMLVGAAQTPQALMNIIKPPVQDPQGFLEQHIQRDL
EQLTKILGKSADETTHVVHLILSSLLKEQHQMTLNFTEVLSTKGCRNNWEKHFGTLLLRE
LKHLDKTLPAINARISQDERISSNPVTKIIYGDPATFLPHLPQKSVVHCSKIWSCRTKIT
VEYLQHIVEQKNGKETVPLLWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVSEVEFSS
IRSFIHSHHSDGLQKLLHDRITVFLSTWNALRRSLETNGEIKLPKDYCRSDLDLDAKFEV
ILPRRRGLGLCGTALVSYLISLHNKMVYVVQKLSNEDNSYSVDTSEVADLHVISYDVERD
LNPLILSNCQYQVQQGGETSQEFDLEKIQRQISSRFLQGKPRLTLKGIPTLVYRRDWNYE
HLFMDIKNKMTQNPLPNSAINAISGQLQSYSDACEALSIVEVTLGFLSTAGGDPSMELNV
YIQEVLQMCDQTSQVLKALNRCQLRHIIALWQFLSAHKSERRLRLKKELFQEVDVKYKED
LSPRHARLLSTFLNEAGLDSFLLELHEMIVLKLRGAQAESSFNPSWSLKDTLVSYMETKD
SDVLTEVESQFPDEILMSSCVSVWKTAATRKWDRQSR
Download sequence
Identical sequences ENSRNOP00000049006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]