SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000050451 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000050451
Domain Number 1 Region: 110-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.12e-33
Family BAR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-20
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 446-502
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-16
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 4 Region: 345-431
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-16
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000050451   Gene: ENSRNOG00000023965   Transcript: ENSRNOT00000041583
Sequence length 508
Comment pep:novel chromosome:Rnor_5.0:2:256813220:256839452:-1 gene:ENSRNOG00000023965 transcript:ENSRNOT00000041583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKPNLLDMGSLMIKPIQRVMKYPLLLCELRNSTPPSHPDYRALEEAFAAVKDINVNINEL
KRRKDLVLKYKKNEEEESLKDKLSRLNIHSISKKSKRVTNHLKILTRGDSQVKDNTFNRE
EKLFRSLEKTVRLCVKNISSCLQHIEVDPHPVFLITKVAALCEISYKDGEKNCMEPQSQA
SNPCHDFAARSQRLILSPLSTLLSLFPGPQKLIQKRYDKLLDCNSSLPRSATTESDLAKR
EYEALNAQLVEELQAFNQAARKILLNCLLSFVTLLRDLMLVALQAYSTVKTVPLPVLGIS
EIQNQVLEEVHSLNFVKDNSATFIERKLSFEKKKPTQVLPEVPHQTDVHRSKLLSTYGAE
ELYRAKRKCNATQEHDVSLLEGELVAVLEQKDPLGSTSRWFVDTGFVKGYVYSSFLRPYN
PGKEQKVDAENRFCDDDADNFQEVDEQVFYAVHAFQARSDHELSLQEYQRVHILRFCDLS
GNKEWWLAETQGQKGYVPANYLGRMTYA
Download sequence
Identical sequences ENSRNOP00000050451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]