SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051450 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051450
Domain Number 1 Region: 913-1104
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 66-99
Classification Level Classification E-value
Superfamily WW domain 0.00000964
Family WW domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051450   Gene: ENSRNOG00000016566   Transcript: ENSRNOT00000052227
Sequence length 1109
Comment pep:known chromosome:Rnor_5.0:7:117776694:117869344:-1 gene:ENSRNOG00000016566 transcript:ENSRNOT00000052227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSQTQDYECRSHHVDEQEPRIPGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPAG
VRIKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTESPRA
SADSSPGRGSRDGSTGSSLEPEPEERAQELPVRGGRATTLVTSKEETSSCSPPGVLLEKD
YEVYRDYSADGQLLHYRTSSLRWNSGNKERMLIKVADREPSFLTPQGNGYPADNQPVGHH
RRPSGSQHSPNLQTFVPDNDGTVFFPERRPSPFLRRAELSGNCSPLLIQPRKPSSDSQPS
SPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEPNSPYQTGSPQRSPGRKPHPFLQATKQ
TPTSPCQQLMRTKQKCPERFLSLEYSPVGKEYVRQLVYVEQAGSSPKLRAGPRHKYAPNP
GGGTYSLQPSPCLLRDQRLGVRSGDYSTMEGPESRSSQPPTPLPQAQEDAMSWSSQQDTM
SSTGYSPGTRKRKNRKPSLCQVPSTSSTDGAGDLLGDQPLTEERSPCRSSLTPVKAETDL
VRGTPEPFLAQARLAWEAQQAHFHMKQRGSWDSQQDGSGYESDGAVPLPMPGPVVRAFSE
DEALAQQDSKHWKRSTFEKLGFPQILLEKSISVQTNLASPEPYLHPSQSEDLGACAQFEN
SRQNRSAVPSSSCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANMLAWSSE
SIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSAQGLRDELY
IQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTQHI
KELLERNSKKKSKLRKKPKPYVEEPDGVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEE
IRHAKNAVFSPSMFGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVP
GDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPE
AAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCQSDDPR
VIFENTRKEMSFLRVLIQHLDTSFMEGVL
Download sequence
Identical sequences F1LR18
ENSRNOP00000051450 10116.ENSRNOP00000051450 ENSRNOP00000022350 NP_775145.2.100692 NP_775145.2.4139 XP_017450543.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]