SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059526 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059526
Domain Number 1 Region: 119-233
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-27
Family SH2 domain 0.00063
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.0000956
Family ATP sulfurylase catalytic domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059526   Gene: ENSRNOG00000028685   Transcript: ENSRNOT00000064592
Sequence length 239
Comment pep:novel chromosome:Rnor_5.0:3:120827512:120837367:-1 gene:ENSRNOG00000028685 transcript:ENSRNOT00000064592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPYEAQKMMAEIRGSKETAVQPLPLYDTPYEPEDEGASLEGEGAPWPRESRLPEDDERP
PEEYDQPWEWKKERISKAFAAQFEGSEKNCLSPGREEKGRLPPRLSAGNPKTAKPLGAEP
SSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSESSKNDFSLSLKSS
QGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences ENSRNOP00000059526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]