SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060708 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060708
Domain Number 1 Region: 396-490
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.88e-37
Family Small-conductance potassium channel 0.00000278
Further Details:      
 
Domain Number 2 Region: 265-436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060708   Gene: ENSRNOG00000016675   Transcript: ENSRNOT00000067262
Sequence length 583
Comment pep:known chromosome:Rnor_5.0:18:38985930:39129190:1 gene:ENSRNOG00000016675 transcript:ENSRNOT00000067262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCRYNGGVMRPLSNLSSSRRNLHEMDSEAQPLQPPASVVGGGGGASSPSAAAAASSSA
PEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGGGGGSGHGSSSGTKSSKKKNQNIGY
KLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTI
ILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTA
RLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTR
FVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSI
GYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRV
KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQKKKLRSVKMEQRKLNDQA
NTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQ
RDFIETQMENYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences E9PSQ3
ENSRNOP00000060708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]