SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063026 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063026
Domain Number 1 Region: 885-1065
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.36e-39
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 472-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.67e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 688-881
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-34
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 4 Region: 278-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 27-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-29
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 6 Region: 1102-1188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000554
Family Laminin G-like module 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000063026
Domain Number - Region: 210-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063026   Gene: ENSRNOG00000021103   Transcript: ENSRNOT00000066418
Sequence length 1188
Comment pep:known chromosome:Rnor_5.0:1:228789673:228870881:1 gene:ENSRNOG00000021103 transcript:ENSRNOT00000066418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGSRWRPPPQLPPLLLLLALVAGVRGLEFGGGPGQWARYARWAGAASTGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEGEPRQEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSHNPIQSS
TDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFND
NAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIG
GSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVA
ALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGAGVGSHSSSQR
ADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTP
FLATGESEVLDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDL
RGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVCEREA
TVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQM
KLTVNLDCLRVGCAPSAAGKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQ
MAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIV
IELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHS
NGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDAPSTACPSSPAAGTGVGQRERTGFPGLCRMCYYGGDSCHTSGTTYIFGKGGAL
ITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHI
Download sequence
Identical sequences ENSRNOP00000063026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]