SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063051 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063051
Domain Number 1 Region: 213-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-58
Family Voltage-gated potassium channels 0.00042
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 6.8e-25
Family Tetramerization domain of potassium channels 0.00000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063051   Gene: ENSRNOG00000018283   Transcript: ENSRNOT00000024600
Sequence length 511
Comment pep:novel chromosome:Rnor_5.0:2:229404139:229405674:1 gene:ENSRNOG00000018283 transcript:ENSRNOT00000024600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCSWREMEVALVNFDNSDEIHEEPGYATDFDPTSSKGRPGSSPFSNWKVLISDNISHE
TAFSKIPGEYVDPPGSEPVVLNEGNQRVIINIAGLRFETQLRTLNQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPTINTNKTGLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKPDFF
KNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKPNIPGEL
DKILNSMGSRTGSTESLNKTNSSRSAEKSRK
Download sequence
Identical sequences D3ZRW4
ENSRNOP00000063051 ENSRNOP00000063051 ENSRNOP00000064519 10116.ENSRNOP00000063051 NP_001178642.1.100692 NP_001178642.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]