SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064087 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064087
Domain Number 1 Region: 37-212
Classification Level Classification E-value
Superfamily Lysozyme-like 1.44e-23
Family G-type lysozyme 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064087   Gene: ENSRNOG00000048571   Transcript: ENSRNOT00000071722
Sequence length 212
Comment pep:novel chromosome:Rnor_5.0:9:44274298:44283738:-1 gene:ENSRNOG00000048571 transcript:ENSRNOT00000071722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPRWVFWGLIALIGTARGSYPGFTHSTNPHVHSRLYHGCYGDVMTMETFGAPCDINNLMN
CGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPALIAAIISRESHGGAVLQNGWDHKG
QRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIKALKRKFPTWNAAQHLKGGLTAFK
SGMETIVTPADIEGDLVDDIIARAKFYKRHGF
Download sequence
Identical sequences M0R412
ENSRNOP00000064087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]