SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064395 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064395
Domain Number 1 Region: 38-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-29
Family Nuclear receptor 0.00017
Further Details:      
 
Domain Number 2 Region: 107-121,163-295
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-24
Family Nuclear receptor ligand-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064395   Gene: ENSRNOG00000050690   Transcript: ENSRNOT00000073122
Sequence length 295
Comment pep:known_by_projection chromosome:Rnor_5.0:8:64555321:64557833:-1 gene:ENSRNOG00000050690 transcript:ENSRNOT00000073122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTVSASVVPMAVTASKKESPGRWGLGEDPTGVGPSLQCRVCGDSSSGKHYGIYACNGC
SGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSL
AQVHLESMEPGSDPRPEPVVASPALAGPSPRGPTSVSAARAMGHHFMASLISAETCAKLE
PEDAEENIDVTSNDPEFPASPCNLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILL
EEAWNELFLLGAIQWSLPLDSCPLLAPPEASSSSQGRLALASAEMRFLQETISRF
Download sequence
Identical sequences ENSRNOP00000064395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]