SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065101 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065101
Domain Number 1 Region: 112-123,214-448
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-50
Family Nuclear receptor ligand-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 39-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065101   Gene: ENSRNOG00000013232   Transcript: ENSRNOT00000074794
Sequence length 462
Comment pep:known chromosome:Rnor_5.0:3:28258302:28400493:-1 gene:ENSRNOG00000013232 transcript:ENSRNOT00000074794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFCQDELAELDPGTNGETDGLTLGQGHIPVSVPDDRAEQRTCLICGDRATGLHYGIISCE
GCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGG
RNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRVSESNQPSPGSTLSS
SRSVELNGFMTFRDQYMGMSVPPHYQYIPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLM
SAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTC
LLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHK
FHQLKVSNEEYACMKAINFLNQDIRGLSSASQLEQLNKRYWYICQDFTEYKYTHQPNRFP
DLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSTVKE
Download sequence
Identical sequences ENSRNOP00000065101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]