SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066022 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066022
Domain Number 1 Region: 20-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-48
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 258-456
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-45
Family BAR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 758-820
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.0000245
Further Details:      
 
Domain Number 4 Region: 523-599
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066022   Gene: ENSRNOG00000050742   Transcript: ENSRNOT00000075661
Sequence length 823
Comment pep:known_by_projection chromosome:Rnor_5.0:1:271071975:271095809:-1 gene:ENSRNOG00000050742 transcript:ENSRNOT00000075661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLSSQSSSLAAPSGSVSTEKPEQRMLEKRAKVVAELLQTEKDYIRDLEMCVERVMVPL
QQAQVPNIDFEGLFGNMQTVIKVSKQLLAALEITDAVGPVFLDHRDELEGTYRLYCQNHD
EAISLLDIYEKDERIQKHLQDYLADLKSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLM
ELLNSTPESHPDKAPLTSAVLAIKEINANINEYKRRKDLVLKYRKADEDSLMEKISKLNI
HSIIKKSSRVSSHLKHLTGFAPQLKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRES
ACVKVVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMF
TGPYKLVQKRFDKLLDFYNCTERAEKLKDKKTLEDLQSARNNYEALNSQLLDELPKFQQY
AQSLFTNCIHGYAEAHCDFVQKALEQLQPLLSLLKASDREGNLIAIFHEEHSRVLQQLQV
FTFFPEALPAPRKPFERKTTDRQSSRKALLGMPSYMLQSEELRSSLLARYPPEKLFHVQR
NFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTKGFVYSSFLKPYNPRCSHSD
SSVVSHSSTESEHSGSSPSFHRQNSSSALTFNSNSMTVSFTSGLPQKQPQDTSPLRECVP
ETLGVSSNTGNPETGPSPCPSDPGFSCQRRPGNPADGTREISQPASTLRGCQRRSLHSEV
LGYPVPGRSDQGSDSIKGTSRACQTAGDRDRGLGSSEAEGNQVYFAIYTFKARNPNELTV
LANQRLRILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences XP_017445213.1.4139 XP_017445872.1.100692 ENSRNOP00000066022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]