SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066383 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066383
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 23-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000324
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066383   Gene: ENSRNOG00000047647   Transcript: ENSRNOT00000073144
Sequence length 267
Comment pep:known chromosome:Rnor_5.0:17:72202947:72250588:-1 gene:ENSRNOG00000047647 transcript:ENSRNOT00000073144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPHLLMLGFLSFTIVPGCWAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNE
LVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHC
REPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCV
DEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVAS
CIFLLLSILLLSGFTWQHRWRKSRRTI
Download sequence
Identical sequences P26897
ENSRNOP00000066383 NP_037295.1.100692 NP_037295.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]