SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067519 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067519
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-35
Family Netrin-like domain (NTR/C345C module) 0.00031
Further Details:      
 
Domain Number 2 Region: 90-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-20
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067519   Gene: ENSRNOG00000046848   Transcript: ENSRNOT00000074047
Sequence length 351
Comment pep:known chromosome:Rnor_5.0:8:102910334:102934915:1 gene:ENSRNOG00000046848 transcript:ENSRNOT00000074047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPEGKVVVLNFRFIDLENDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGSLVASGNKMMV
QMISDANTAGSGFMATFSAAAPDGKGDRYCGGRLEKPSGSFKTPNWPDRDYPVGVTCVWH
IIAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEVNDAKRIGKYCGDSPPVPIVSEKN
ELLIQFLSDLSLTADGFIGHYKFRPKKFPTTTATPVTTTFPVTIGLKPTVALCQQKCRRM
GTLESNYCSSNFVLAGTVITTATRGGSLLATVSIISIYREGNLAIQQAGKNMSVKLTVVC
RQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFVKMFKNKNQKPMNALKNKQC
Download sequence
Identical sequences ENSRNOP00000067519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]