SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067882 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067882
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-19
Family G-type lysozyme 0.00000993
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067882   Gene: ENSRNOG00000047233   Transcript: ENSRNOT00000074343
Sequence length 197
Comment pep:novel chromosome:Rnor_5.0:9:44302751:44314511:-1 gene:ENSRNOG00000047233 transcript:ENSRNOT00000074343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLWLLLGLLALTGSSESSNWGCYGNIRTLDTPGASCRIGRRYGLSYCGVRASERLAEV
DRPYLLRYQPTMRLVGQKYCMDPAVIAGVLSRESPGGNFVLDMGNMGSGLGMVKESKFYP
PTAWKSETWVSQKTQTLTSSIKEIKTRFPTWTTDQHLRGGLCAYSKGPNFVRSNQDLNCD
FCNDVLARAKYFKNHGF
Download sequence
Identical sequences D3ZZJ5
ENSRNOP00000025065 ENSRNOP00000067882 NP_001092308.1.100692 XP_006244930.1.100692 XP_008756240.1.4139 10116.ENSRNOP00000025065 ENSRNOP00000025065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]