SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000071 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000071
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000135
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000000071
Domain Number - Region: 140-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00157
Family Ubiquitin-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000071   Gene: ENSRNOG00000000062   Transcript: ENSRNOT00000000071
Sequence length 241
Comment pep:known chromosome:RGSC3.4:14:1784370:1839191:-1 gene:ENSRNOG00000000062 transcript:ENSRNOT00000000071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLD
PRNGETKADDNSNKETAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQAT
VLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDL
L
Download sequence
Identical sequences B2RZ26 Q8BTQ0
ENSRNOP00000000071 ENSMUSP00000041790 NP_001100715.2.100692 NP_001100715.2.4139 NP_766304.2.92730 10090.ENSMUSP00000041790 10116.ENSRNOP00000000071 ENSRNOP00000000071 ENSMUSP00000041790 ENSMUSP00000041790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]