SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000451 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000451
Domain Number 1 Region: 29-496
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-90
Family L-arabinose binding protein-like 0.0000644
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000000451
Domain Number - Region: 520-565
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00589
Family TNF receptor-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000451   Gene: ENSRNOG00000000401   Transcript: ENSRNOT00000000451
Sequence length 928
Comment pep:known chromosome:RGSC3.4:20:30235063:30256951:-1 gene:ENSRNOG00000000401 transcript:ENSRNOT00000000451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSFVFITCFMILLDTSQSCHTPDDFVAITSPGHIMIGGLFAIHEKMLSSDDHPRQPQI
QKCVGFEISVFLQTLAMIHSIEMINNSSLLSGVKLGYEIYDTCTEVTAAMAATLRFLSKF
NCSRETVIFQCDYSSYVPRVKAIIGAGYSEISMAVSRMLNLQLMPQVSYESTAEILSDKI
RFPSFLRTVPSDFYQTKAMAHLIRQSGWNWVGAITTDDDYGRLALNTFAIQAAENNVCIA
FKEVLPAFLSDNTIEVRINQTLEKIIAEAQVNVIVVFLRKFHVFNLFNKAIERKISKIWI
ASDNWSTAAKIITIPNVKKLGKVVGFTFRRGNMSSFHSFLQTLHMYPSDNNKPLHEFAML
FSACKHIKDGDLSQCISNYSQATWTYDTTKTIETHLFKRNDFLWHYTEPGLIHSIQLAVL
ALGHAIRDLCQDRDCQKPNAFQPWELLAVLKNVTFTDGKNSFHFDAHGDLNTGYEVVLWK
ETNGLMTVTKMAEYDLQHDVFITTNQETKHEFRKLKQILSKCSKECIPGQMKKATGSQHS
CCYECVNCPENHYSNETDMDHCLVCNNETHWAPVRSTMCFEKEVEYLDWDDSLALLLIAL
SLLGIAFVLAVGIIFTRNLKTPVVKSSGGLVVCYVMLACHALNFASTGFFIGEPQDFTCK
TRQTLFGVSFTLCVSCILTKSLKILLAFSFDPTLKTFLKCLYRPVPIVLTCTGIQVVICT
LWLVLAAPTVEENTSLPRVIILECEEGSALAFGTMLGYIAVLAFICFVFAFKGRKLPENY
NEAKFLTFGMLIYFIAWITFIPVYATTFGKYLPAVEIIVILISNYGILCCTFFPKCYIIL
CKQKTNTKSVFLQMVYNYSAHSVDSLALSHVSLDSASHSTATTNPRPGNKTAACQNYKHL
PVQVLAHTGMEKTMHASKTLHQKRSSSI
Download sequence
Identical sequences Q70VB1
NP_001258035.1.100692 NP_001258035.1.4139 ENSRNOP00000000451 ENSRNOP00000000451 10116.ENSRNOP00000000451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]