SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001158 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001158
Domain Number 1 Region: 256-454
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-48
Family DBL homology domain (DH-domain) 0.0000000935
Further Details:      
 
Domain Number 2 Region: 447-571
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-36
Family Pleckstrin-homology domain (PH domain) 0.000000611
Further Details:      
 
Domain Number 3 Region: 22-141
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-28
Family Calponin-homology domain, CH-domain 0.00072
Further Details:      
 
Domain Number 4 Region: 185-255
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-24
Family SH3-domain 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001158   Gene: ENSRNOG00000000869   Transcript: ENSRNOT00000001158
Sequence length 787
Comment pep:known chromosome:RGSC3.4:X:141946362:142068629:-1 gene:ENSRNOG00000000869 transcript:ENSRNOT00000001158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRMWLSPHSCPESCSERTRASVMNPEERVVTWLISLGVLESPKKTICDPEEFLKSSLK
NGVVLCKLISRLLPGSVEKYCQEPQTEADCIDNINDFLKGCATLQVEVFEPDDLYSGANF
SKVLNTLLAVNKATEDQLSERPCGRSSSLSATTSSQTNPQAAVPSTTPEQQSEEKAAMTE
NGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREI
KPSERPLSPKAVKGFDTAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNL
STVEFTCLLGNFEEVCTFQQTLCQALEECSKSPENQHKVGGCLLNLMPHFKSMYLAYCAN
HPSAVNVLTQHSDDLERFMENQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDT
HPDHQDILKAIIAFKSLMGQCQDLRKRKQLELQILSEPIQAWEGDDIKTLGNVIFMSQVV
MQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKVPIAGMVVTRLDEIEGNDCTFE
ITGGTVERIVVHCNNNQDFQEWMEQLNRLTKGPASCSSLSKTSSSSCSTHSSFSSTGQPR
GPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKEESSKSPKTMKKFLHKRKTERKTSEEEY
VIRKSTAALEEDAQILKVIEAYCTSASFQQGTRKDSVPQVLLPEEEKLIIEETRSNGQTI
IEEKSLVDTVYALKDEVKELKQQAQVWQCLSTILATRKTLEKLLPMLLKQTDECIRAESS
SKTSILQ
Download sequence
Identical sequences 10116.ENSRNOP00000001158 ENSRNOP00000001158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]