SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001412 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001412
Domain Number 1 Region: 53-246
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-79
Family Sec7 domain 0.00000000598
Further Details:      
 
Domain Number 2 Region: 255-370
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-34
Family Pleckstrin-homology domain (PH domain) 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001412   Gene: ENSRNOG00000001065   Transcript: ENSRNOT00000001412
Sequence length 390
Comment pep:known chromosome:RGSC3.4:12:11169430:11198148:-1 gene:ENSRNOG00000001065 transcript:ENSRNOT00000001412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQI
AMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKV
LQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTC
YVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKI
PEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP
LENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKE
EWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences ENSRNOP00000001412 10116.ENSRNOP00000001412 ENSRNOP00000001412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]