SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001712 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001712
Domain Number 1 Region: 94-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000275
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001712   Gene: ENSRNOG00000001270   Transcript: ENSRNOT00000001712
Sequence length 269
Comment pep:known chromosome:RGSC3.4:12:35537755:35560336:-1 gene:ENSRNOG00000001270 transcript:ENSRNOT00000001712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSHDQKAVTRRTKVAPTKRMSRFLKHFTVVGDDYHTWNVNYKKWENEEDEEEPAPTSAE
GEGSAVGPDAEAGSASTPRPSLDFRSRLRKLFSSHRFQVIIICLVVLDALLVLAELLLDL
RIIEPDLSKYSTKVFHYLSLAILAFFVLEISLKVFVFRLEFFHHKFEILDAIVVVVSFVL
DLILLFKNHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQINLQLATKIQH
LEFSCSEKEQEIERLSKLLRQNGLLEDVN
Download sequence
Identical sequences 10116.ENSRNOP00000001712 ENSRNOP00000001712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]