SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003139 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003139
Domain Number 1 Region: 36-80
Classification Level Classification E-value
Superfamily TNF receptor-like 6.71e-17
Family BAFF receptor-like 0.00086
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000029
Family BAFF receptor-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003139   Gene: ENSRNOG00000002304   Transcript: ENSRNOT00000003139
Sequence length 249
Comment pep:known chromosome:RGSC3.4:10:47286657:47295026:1 gene:ENSRNOG00000002304 transcript:ENSRNOT00000003139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMALCPKKQYWDSLKRTCVSCVLTCSQRSQRTCTDFCKFINCRKEQGKYYDHLLGTCVS
CDSTCTQHPQQCAQFCEKRPRSQVNLQSELRRPETREVEARPDNLGRYQGSEHSPGLRMN
SDQLTLYCTLGVCLCAIFCCFLVALASFLRRRGEPLPSQPAGQRGSQANSPHGRRPMTEA
RNEVAMPPQPVETCSFCFPERSSPTQESAPRSLGIHGFAGTAAPQPCMRASVSGLAVVRT
PTGDERPGA
Download sequence
Identical sequences F1LX35
ENSRNOP00000003139 ENSRNOP00000003139 10116.ENSRNOP00000003139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]