SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004196 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004196
Domain Number 1 Region: 59-270
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-76
Family Sec7 domain 0.00000000811
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000004196
Domain Number - Region: 12-65
Classification Level Classification E-value
Superfamily FlgN-like 0.0602
Family FlgN-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004196   Gene: ENSRNOG00000043381   Transcript: ENSRNOT00000004196
Sequence length 289
Comment pep:known chromosome:RGSC3.4:10:108189310:108253419:-1 gene:ENSRNOG00000043381 transcript:ENSRNOT00000004196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRGESKSNF
LNQTCSVIFCQNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLG
Download sequence
Identical sequences ENSRNOP00000004196 10116.ENSRNOP00000004196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]