SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004637 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004637
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily DEATH domain 0.0000647
Family Pyrin domain, PYD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004637   Gene: ENSRNOG00000042990   Transcript: ENSRNOT00000004637
Sequence length 128
Comment pep:known chromosome:RGSC3.4:13:89724135:89725619:-1 gene:ENSRNOG00000042990 transcript:ENSRNOT00000004637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IICKMVNEYKEIVLIKGLEDMKDYAFRTIKSLLRKELNLTKKMQDDYDRIQLADLLEDKF
PQDAGLSKLIEVCESIEELKELTDNLKIQKKNKKKGKTAVKKRKQDEPSTSESNKNKPSS
KVRWLISH
Download sequence
Identical sequences ENSRNOP00000004637 10116.ENSRNOP00000004637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]