SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007268 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007268
Domain Number 1 Region: 336-417
Classification Level Classification E-value
Superfamily DEATH domain 1.62e-22
Family DEATH domain, DD 0.00000688
Further Details:      
 
Domain Number 2 Region: 86-124
Classification Level Classification E-value
Superfamily TNF receptor-like 2.59e-16
Family TNF receptor-like 0.0001
Further Details:      
 
Domain Number 3 Region: 32-84
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000565
Family TNF receptor-like 0.0000717
Further Details:      
 
Domain Number 4 Region: 125-166
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000127
Family TNF receptor-like 0.000089
Further Details:      
 
Domain Number 5 Region: 167-190
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000968
Family TNF receptor-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007268   Gene: ENSRNOG00000005392   Transcript: ENSRNOT00000007268
Sequence length 425
Comment pep:known chromosome:RGSC3.4:10:84262802:84281006:-1 gene:ENSRNOG00000005392 transcript:ENSRNOT00000007268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGAACSAMDRLRLLLLLILGMSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGA
NQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEET
GHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRE
CTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSS
QPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGE
KLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHL
AGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSEST
ATSPV
Download sequence
Identical sequences G3V6P1
ENSRNOP00000007268 NP_036742.2.100692 NP_036742.2.4139 ENSRNOP00000007268 10116.ENSRNOP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]