SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008161 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008161
Domain Number 1 Region: 531-694
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-52
Family Sec7 domain 0.0000581
Further Details:      
 
Domain Number 2 Region: 730-866
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-25
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008161   Gene: ENSRNOG00000006079   Transcript: ENSRNOT00000008161
Sequence length 1007
Comment pep:known chromosome:RGSC3.4:3:2622918:2659328:1 gene:ENSRNOG00000006079 transcript:ENSRNOT00000008161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGDHLRPMEFLNICLEDNLQPHPEAYPSEVHGHPGPSEPCQEHTWPFDPPESARPDAHH
GDSDVEPSHLGNRLVHGEASQAPASSRSLEDNSSLGSPQQNRSSSTQVVFWAGILQAQMC
VLDLEEELEKTEGLKAGLRCCIPPPSKDFLGDVGLKPSRPKEDEDSGDDSSGSEEENQTW
PKKKMPGSSPEWGAEEDSIFFDNPLFLESPCSDTSTEGECFSWGYPNSHLDMKTWPHRPQ
TLDSPLQEGTGLWTQENDLDLGSNTADHSRCSTPPFPVPSYKMHPCLALGSTEGAPIVPP
DQVGETSWEDDVGPGSPKAPSVDHELIQESDNFGSDLRPATTHPVQPWGSQIPQSLSDLA
PPLHEDLQDPSRPQKPLISQNGGERDAGCFQEPMLCTLAPWGSQASLLEPSCPESGGRGS
GPRPSPVSSQESSPQDQLHSLKWPQDTSHPSLLEKDKSELSSLKKDETEEVPSLMQEAEC
EDTSRSEDASVTEHHVHLASAEGLPESPMPPEEAQSPEEDWRPSPSREKMANSIRNDEGA
WNLALRLYQLNGFRKSEVAAHLRKNNDFSRAVAEAYLSFFQFEGQSLDRALRGFLQALVL
SGETQERERILYQFSKRFHYCNPGAFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEF
VTNLNGLQDGGNFPKELLKALYWSIRSEKLEWAVDEEDAARPEKDQPSPSAGKISSPFLQ
LAQDPTMPTYKQGILARKMHHDADGKKTPWGKRGWKMFHTLLRGMVLYFLKGEGQWLDGE
SLVGHMMDEPVGVHHSLASPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMASWIARINL
AAATHSAPPFPAAVGSQRRFVRPILPMGPAQSSLEEQHRSHENCLDAASDDLLDLQRNLP
ERRGRSRELEEYRLRKEYLEHEKTRYETYVQLLVARLHFPLKDLALWEDQLGNEADSCQE
PRPSLKKSHSSPSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL
Download sequence
Identical sequences D3ZPP3
ENSRNOP00000008161 10116.ENSRNOP00000008161 ENSRNOP00000008161 NP_001128353.1.100692 NP_001128353.1.4139 XP_006233653.1.100692 XP_006233654.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]