SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008707 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008707
Domain Number 1 Region: 143-386
Classification Level Classification E-value
Superfamily vWA-like 9.71e-77
Family Integrin A (or I) domain 0.000000586
Further Details:      
 
Domain Number 2 Region: 388-473
Classification Level Classification E-value
Superfamily Integrin domains 4.39e-19
Family Integrin domains 0.0021
Further Details:      
 
Domain Number 3 Region: 45-100
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 590-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Integrin beta EGF-like domains 0.0046
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Integrin beta EGF-like domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000008707
Domain Number - Region: 514-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008707   Gene: ENSRNOG00000006569   Transcript: ENSRNOT00000008707
Sequence length 767
Comment pep:known chromosome:RGSC3.4:6:146494978:146572075:-1 gene:ENSRNOG00000006569 transcript:ENSRNOT00000008707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSALAFLTAALLCLHNCQRGPALVLGAAWVFSLVLGLGQSEHNRCDSANVVSCARCLQ
LGPECGWCVQEDFVSGGSRSERCDTVSNLISKGCPVDSIEYLSVHVVTSSENEINTQVTP
GDVSIQLHPGAEANFMLKIRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALF
SHDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
AIAGEIESKAANLNNLVVEAYKKLISEVKVQLESQVHGVHFNITAICPDGARKPGTSGCG
NVTSNDEVLFNVTVVMKTCDIIGGKNYAIIKPIGFNETTKVHIHRSCSCQCEDHRGLKGQ
CAEAAPDPKCPQCDDGKCHFDEDQFPSEACKPQEDQPVCSGRGVCICGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCSGHGECEGGRCQCFNGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRLCEHCPTCHLSCSENWNCLQCLHPHNLSQAVLDQCKASC
AVMEQHPVAQTSECLSGPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAQEAFRCNF
Download sequence
Identical sequences A0A0G2JVU1
10116.ENSRNOP00000008707 ENSRNOP00000008707 XP_006240759.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]