SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008872 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008872
Domain Number 1 Region: 1-59,123-136
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.2e-17
Family PDEase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008872   Gene: ENSRNOG00000006154   Transcript: ENSRNOT00000008872
Sequence length 155
Comment pep:known chromosome:RGSC3.4:3:62650092:62674766:-1 gene:ENSRNOG00000006154 transcript:ENSRNOT00000008872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDSTEKIVIPLIEEA
SKPESSNYGASSSSTMIGFHVADALRRSNTKGCMSDGTYAPDYSLSAVDLKSFKNNLVDI
IQQNKERWKELAAQGELDLHKNSEDLEEKHADTHP
Download sequence
Identical sequences ENSRNOP00000008872 10116.ENSRNOP00000008872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]