SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009241 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009241
Domain Number 1 Region: 2216-2723
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.32e-97
Family Acetylcholinesterase-like 0.0000326
Further Details:      
 
Domain Number 2 Region: 983-1079
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.33e-22
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 719-782,897-927
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.05e-19
Family Thyroglobulin type-1 domain 0.0051
Further Details:      
 
Domain Number 4 Region: 92-166
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-19
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 5 Region: 25-93
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-18
Family Thyroglobulin type-1 domain 0.0019
Further Details:      
 
Domain Number 6 Region: 297-360
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.54e-16
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1138-1215
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000129
Family Thyroglobulin type-1 domain 0.0019
Further Details:      
 
Domain Number 8 Region: 614-663
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000144
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 9 Region: 657-723
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000000000209
Family Thyroglobulin type-1 domain 0.0021
Further Details:      
 
Domain Number 10 Region: 164-196,231-249
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000119
Family Thyroglobulin type-1 domain 0.0052
Further Details:      
 
Domain Number 11 Region: 1511-1558
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000942
Family Thyroglobulin type-1 domain 0.007
Further Details:      
 
Domain Number 12 Region: 1096-1149
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000183
Family Thyroglobulin type-1 domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000009241
Domain Number - Region: 1441-1492
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00942
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009241   Gene: ENSRNOG00000006104   Transcript: ENSRNOT00000009240
Sequence length 2768
Comment pep:known chromosome:RGSC3.4:7:104035776:104220754:1 gene:ENSRNOG00000006104 transcript:ENSRNOT00000009240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTLVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQ
TVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQ
CQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKS
PPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCAD
SQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
KCEVEQFTATSFGHPYIPSCHRDGHYQTVQCQMERMCWCVDAQGIEIPGTRQQGQPLFCA
KDQSCASERQQALSRLYFETPGYFSPQDLLSSEDRLVPVSGARLDISCPPRIKELFVDSG
LLRSIAVERYQQLSESRSLLREAIRAIFPSRELAGLALQFTTNPKRLQQNLFGGTFLVNA
AQLNLSGALGTRSTFNFSQFFQQFGLPGFLVRDRATDLAKLLPVSLDSSPTPVPLRVPEK
RVAMNKSVVGTFGFKVNLQENQDALKFLVSLMELPEFLVFLQRAVSVPEDRARDLGDVME
MVFSAQACKQTSGRFFVPSCTAEGSYEDIQCYAGECWCVNSQGKEVEGSRVSGGHPRCPT
KCEKQRAQMQNLAGAQPAGSSFFVPTCTSEGYFLPVQCFNSECYCVDAEGQVIPGTQSTI
GEPKLCPSVCQLQAEQAFLGVVGVLLSNSSMVPPISSVYIPQCSTSGQWMPVQCDGPHEQ
VFEWYERWNTQNSDGQELTTATLLMKLMSYREVASTNFSLFLQSLYDAGQQSIFPVLAQY
PSLQDVPQVVLEGATIQPGENIFLDPYIFWQILNGQLSQYPGPYSDFSMPLEHFNLRSCW
CVDEAGQELDGTRTRAGEIPACPGPCEEVKFRVLKFIKETEEIVSASNASSFPLGESFLV
AKGIQLTSEELGLPPLYPSREAFSEKFLRGSEYAIRLAAQSTLTFYQKLRASLGESNGTA
SLLWSGPYMPQCNTIGGWEPVQCHPGTGQCWCVDGWGELIPGSLMARSSQMPQCPTSCEL
SRANGLISAWKQAGHQRNPGPGDLFTPVCLQTGEYVRQQTSGTGAWCVDPSSGEGVPTNT
NSSAQCPGLCDALKSRVLSRKVGLGYTPVCEALDGGFSPVQCDLAQGSCWCVLASGEEVP
GTRVVGTQPACESPQCPLPFSGSDVTDGVVFCETASSSGVTTVQQCQLFCRQGLWNVFSP
GPLICNLESQRWVTLPLPRACQRPQLWQTMQTQAHFQLLLPPGKMCSIDYSGLLQAFQVF
ILDELITRGFCQIQVKTFGTLVSRTVCDNSSIQVGCLTAERLGVNATWKLQLEDISVGSL
PNLHSIERALMGQDLLGRFANLIQSGKFQLHLDSKTFSADTILYFLNGDRFVTSPMTQLG
CLEGFYRVSTTSQDPLGCVKCPEGSFSQDGKCTPCPAGTYQGQAGSSACIPCPRGRTTTI
TGAFSKTHCVTDCQRDEAGLQCDQNGQYQANQKDMDSGEVFCVDSEGQRLQWLQTEAGLS
ESQCLMMRKFEKAPESKVIFDASSPVIVKSRVPSANSPLVQCLADCADDEACSFVTVSSM
SSEVSCDLYSWTRDNFACVTSDQEEDAVDSLKETSFGSLRCQVKVRNSGKDSLAVYVKKG
HEFTASGQKSFEPTGFQNVLSGLYSSVVFSALGTNLTDTHLFCLLACDQDSCCDGFIVTQ
VKEGPTICGLLSAPDILVCHINDWRDASDTQANGTCAGVTYDQGSRQMTMSLGGQEFLQG
LTLLEGTQDSFISFQQVYLWKDSDIGSRPESMGCGRGMVPKSEAPEGADMATELFSPVDI
TQVIVNTSHSLPSQQYWLSTHLFSAEQANLWCLSRCAQEPVFCQLADIMESSSLYFTCSL
YPEAQVCDNDVESNAKNCSQILPRQPTALFQRKVVLNDRVKNFYTRLPFQKLSGISIRDR
IPMSEKLISNGFFECERLCDRDPCCTGFGFLNVSQMQGGEMTCLTLNSMGIQTCSEENGA
TWRILDCGSEDTEVHTYPFGWYQKPAVWSDAPSFCPSAALQSLTEEKVALDSWQTLALSS
VIIDPSIKHFDVAHISISATRNFSLAQDFCLQECSRHQDCLVTTLQIQQGVVRCVFYPDI
QSCEHSLRSKTCWLLLHEEAAYIYRKSGAPLHQSDGISTPSVHIDSFGQLQGGSQVVKVG
TAWKQVYQFLGVPYAAPPLAENRFQAPEVLNWTGSWDATKLRSSCWQPGTRTPTPPQISE
DCLYLNVFVPENLVSNASVLVFFHNTVEMEGSGGQLNIDGSILAAVGNLIVVTANYRLGV
FGFLSSGSDEVAGNWGLLDQVAALTWVQTHIGAFGGDPQRVTLAADRGGADVASIHLLIT
RPTRLQLFRKALLMGGSALSPAAIISPDRAQQQAAALAKEVGCPNSSVQEVVSCFRQKPA
NILNEAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINR
AKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAIWYYSLEHSTDDYASFSRA
LENATRDYFIICPIVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSA
YQGYFSMEEQSLSLKVMQYFSNFIRSGNPNYPHEFSQKAAEFATPWPDFVPGAGGESYKE
LSAQLPNRQGLKKADCSFWSKYIQTLKDADGAKDGQLTKSGEEDLEVGPGSEEDFSGSLE
PVPKSYSK
Download sequence
Identical sequences G3V6V3
10116.ENSRNOP00000009241 NP_112250.2.100692 NP_112250.2.4139 ENSRNOP00000009241 ENSRNOP00000009241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]