SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009292 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009292
Domain Number 1 Region: 267-421
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-19
Family DBL homology domain (DH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009292   Gene: ENSRNOG00000007061   Transcript: ENSRNOT00000009292
Sequence length 848
Comment pep:known chromosome:RGSC3.4:6:3250031:3278339:1 gene:ENSRNOG00000007061 transcript:ENSRNOT00000009292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPKTKQGENEHMPVNNPSTQIYQLQALASELKTGFTEAMQELTRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKAQKEEHGAQAGPASAPASAPAQGSPFRSINVPESGLPSEDFTNMLPSQTYEKAQESRS
VHVGDGNVKGMMGPGVNPTTPESDENLKPSLSAEIQSKGHHTSGLWRQPKDGKEWGEEYV
TKDHPDKLKDSGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATF
QGSDGKRNPKERSLFPGSLRYLIQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNF
LDYYVAYLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQYVLEASS
QLVYAAWLVIQCLRDLRSPGSHPNLLFLCLSNWVVIKNKKWRRFTLAHSFGGPKSHCLKE
KLQHSXTAGQEAVRDSGIHSEEMLQPYPSTPSSAPAVTHLMAPAKKEQQQQSLMESMQPG
KPGDWEMEGRKHERPESLLAPAQFCAAEQDVKALAGPLQAIPEMDFEPSPAEPLGNVERS
LRGPPELLPDARGFVPAGYEEFEYGGEIFALPAPYDEEPFQAPALFDNCSPASSESSLDI
CFLRPVSFAMEAERPEHALQPLPKSATSPASSSGAYKLEAAQAQAHGKAKPLSRSLKEFP
RTPPAEGVAPRLYSTRSSSGGRAPLKVERAPASHGPAAAAAASRGAPRTFFPQQRSQSEK
QTYLEEMHLEDATRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKNGNSAGED
FCGPWGWW
Download sequence
Identical sequences ENSRNOP00000009292 10116.ENSRNOP00000062181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]