SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009359 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009359
Domain Number 1 Region: 567-1043
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-142
Family Ras GEF 0.0000000000000134
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 4.82e-56
Family TBP-associated factors, TAFs 0.0000000906
Further Details:      
 
Domain Number 3 Region: 418-573
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-39
Family Pleckstrin-homology domain (PH domain) 0.000000558
Further Details:      
 
Domain Number 4 Region: 198-400
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-36
Family DBL homology domain (DH-domain) 0.00000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009359   Gene: ENSRNOG00000007106   Transcript: ENSRNOT00000009359
Sequence length 1319
Comment pep:known chromosome:RGSC3.4:6:3308778:3390648:-1 gene:ENSRNOG00000007106 transcript:ENSRNOT00000009359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNEDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPAERIHHLLREVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSY
ESETIFSSQGELESISTKIVGYLNNSIEKTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DVLRPGFHERFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECMKQAITALLNVQSGMEKICSKNLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEHMRLPSADVYRFAEPDSEENILFEENVQPKAGIPI
IKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLLIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDVDLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQNSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLRRHGKELINFSK
RRRVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASSASSNTDVCSVFDSDHSASPFHSRSASVSSISLSKGTEEVPVPPPVP
PRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLL
PPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLP
SPPLTQEVDLHSIAGPPVPPRQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences 10116.ENSRNOP00000061334 ENSRNOP00000009359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]