SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009535 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000009535
Domain Number - Region: 65-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00913
Family I set domains 0.076
Further Details:      
 
Domain Number - Region: 275-314
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009535   Gene: ENSRNOG00000007255   Transcript: ENSRNOT00000009535
Sequence length 326
Comment pep:known chromosome:RGSC3.4:10:87370697:87379595:1 gene:ENSRNOG00000007255 transcript:ENSRNOT00000009535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAWALLSAVLWSLAGVGSARSSLFSNEGFVYGTVGHPVKIYVKLHQTSPVLVCMDIDRA
SKETVDPIYLWIGPNENTLTGSSQINITNIGELVLKDFMESLSGHYSCTLSYKIVKAETQ
EETSLKKKYDFLVFAYREPDYSYRMAVRFTTKSCVGRYNDLLFRLLKKILDNLISDLLCH
VIEPSYKCHSVKIPERDFVYELFVAFQVNPFAPGWKSMCNSSMDCEDVTNHNILKARDRI
EEFFRSQAYILHHHFNITVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCASCCVVCSP
GTFSPDMDVTCQTCVSAHVYGAKACP
Download sequence
Identical sequences Q6X782
ENSRNOP00000048783 10116.ENSRNOP00000048783 NP_001007012.1.100692 NP_001007012.1.4139 ENSRNOP00000009535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]