SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009993 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009993
Domain Number 1 Region: 139-400
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-82
Family Caspase catalytic domain 0.0000000139
Further Details:      
 
Domain Number 2 Region: 3-88
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-23
Family Caspase recruitment domain, CARD 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009993   Gene: ENSRNOG00000007372   Transcript: ENSRNOT00000009993
Sequence length 401
Comment pep:known chromosome:RGSC3.4:8:2027973:2036856:1 gene:ENSRNOG00000007372 transcript:ENSRNOT00000009993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDKILRAKRKQFINSVSVGTINGLLDELLEKRVLNQEEMDTIKLANITVMEKARDLCDHV
TKKGPRASQMFITYICNEDCYLAEILELQSGPSAETVFVTEDSKGGHPFSSETKEKLNKE
GGAFPGPSGSLKFCPLEIAQKLWKENHSEIYPIMKTPTRTRLALIICNTDFQHLSRRVGA
DVDLREMKLLLQDLGYTVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQEG
ICGITYSNEVADILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGNS
EEGFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAWS
CDLEDIFRKVRFSFEQPDSRLQMPTTERVTLTKRFYLFPGH
Download sequence
Identical sequences ENSRNOP00000009993 ENSRNOP00000009993 10116.ENSRNOP00000009993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]