SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010086 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010086
Domain Number 1 Region: 20-49
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000345
Family BAFF receptor-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010086   Gene: ENSRNOG00000007664   Transcript: ENSRNOT00000010086
Sequence length 175
Comment pep:known chromosome:RGSC3.4:7:120596503:120597836:-1 gene:ENSRNOG00000007664 transcript:ENSRNOT00000010086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVRRLRVRSRRSRDSPVSTQCNQTECFDPLVRNCVSCELFYTPETRHASSLEPGTALQP
QEGSGLRPDVALLFGAPALLGLVLALTLVGLVSLVGWRWRQQRRTASLDTSEGVQQESLE
NVFVPPSETLHASAPNWPPFKEDADNILSCHSIPVPATELGSTELVTTKTAGPEQ
Download sequence
Identical sequences D4A281
10116.ENSRNOP00000010086 XP_001077542.1.4139 XP_576316.2.100692 ENSRNOP00000010086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]