SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 69_3.4 > ENSRNOP00000011344

Domain assignment for ENSRNOP00000011344 from Rattus norvegicus 69_3.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000011344
Domain Number 1	Region: 207-286
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.00000000000471
Family	DEATH domain, DD	0.024
Further Details:

Domain Number 2	Region: 103-160
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000000576
Family	TNF receptor-like	0.0026
Further Details:

Domain Number 3	Region: 32-80
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000000138
Family	TNF receptor-like	0.0031
Further Details:

Domain Number 4	Region: 290-371
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.00000000841
Family	DEATH domain, DD	0.037
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000011344 Gene: ENSRNOG00000008336 Transcript: ENSRNOT00000011344
Sequence length	401
Comment	pep:known chromosome:RGSC3.4:7:90606425:90634431:-1 gene:ENSRNOG00000008336 transcript:ENSRNOT00000011344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MNKWLCCALLVFLDIIEWTTQETFPPKYLHYDPETGRQLLCDKCAPGTYLKQHCTVRRKT LCVPCPDYSYTDSWHTSDECVYCSPVCKELQTVKQECNRTHNRVCECEEGRYLELEFCLK HRSCPPGLGVLQAGTPERNTVCKRCPDGFFSGETSSKAPCRKHTNCSSLGLLLIQKGNAT HDNVCSGNREATQNCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERI KRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHIGHANLTTEQLRILME SLPGKKISPDEIERTRKTCKPSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKAYHFPKT VTHSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences	O08727 ENSRNOP00000011344 ENSRNOP00000011344 NP_037002.1.100692 NP_037002.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]