SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011424 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011424
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-23
Family Caspase recruitment domain, CARD 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011424   Gene: ENSRNOG00000008507   Transcript: ENSRNOT00000011424
Sequence length 165
Comment pep:known chromosome:RGSC3.4:7:32515272:32517581:-1 gene:ENSRNOG00000008507 transcript:ENSRNOT00000011424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEATAELPTAQPRKDHLPEKPFIIRLITAA
PREAAPESLSPVAETAQSGQKGRLDQSNSCPSAPVAATEACLDQS
Download sequence
Identical sequences D3ZB14
ENSRNOP00000062865 ENSRNOP00000011424 10116.ENSRNOP00000062865 NP_001101555.1.100692 NP_001101555.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]