SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012148 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012148
Domain Number 1 Region: 58-493
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.1e-91
Family L-arabinose binding protein-like 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000012148
Domain Number - Region: 518-565
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00282
Family TNF receptor-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012148   Gene: ENSRNOG00000009146   Transcript: ENSRNOT00000012148
Sequence length 856
Comment pep:known chromosome:RGSC3.4:7:15229612:15253501:1 gene:ENSRNOG00000009146 transcript:ENSRNOT00000012148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHQLQSSRKNMFILMVVFFLLNLPLLMANFIDPRCFWRINLSKVKEKKLDISCAFIIGAV
QLPVEKDYFNETLNVLKRTKTNKYTLALAFSLDEINRNHKLLPNMSLVIKHTLSYCDGNT
ALHIYKEKFYKPFPNYMCNEETVCSFLLTGMVWRTSITLFSNLDTFLFPCFLQISYGPFQ
TIFSDNDQFPNLYQMTPKDTSLALAMVSFILYFNWNWVGLLISDNDEGNQFLLELRKETQ
NKEVCFAFVNMMKSNEFSFDYKNEMYYKQIVMSSTNVIIIYGETESITELSFRMWKSPVM
QRIWITKSELDFPTSERDLTHGTFYGSLAFLQNHGEISGFKNFAETRYHLRSRDLNLLIP
EWKYFSYEISASNCKILRNFSSNASLEWLTGQKFHMAFNDKSHSIYNAVYAMAHALHENN
LQEVDNEEIRNRKIASTHCLKLNSFLRKTHFTNLLGDRVILKQRRVHEDYDIVHIQNFSQ
QLQIKVKIGKFSPSFPHGEPFLLYGEMMDLAIGSKKLPSSVCSADCSPGFRKIWKEGMAA
CCFLCSPCPENEISNETNMDQCVNCPEYQYAKTEKNKCIQKVVTFLSYEDPLGLALVLIA
FCLSAFTAVVLWVFMKHHDTPIVKANNRILSYILIMSLMSCFLCSFFFIGHPNRGTCILQ
QITFGIVFTVAVSTVLAKTITVVLAFKVTDPGRRLRNFLVSGAPNYIILTCSLLQCILCA
IWLAVSPPFVDIDEHSEHGNIIIVCNKGSIVAFYCVLGYLACLAFGSFTMAFLAKNLPDT
FNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYII
LMKPDRNSIQKIREKS
Download sequence
Identical sequences 10116.ENSRNOP00000041141 ENSRNOP00000012148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]