SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015138 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015138
Domain Number 1 Region: 112-247
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-41
Family PDEase 0.000000245
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015138
Domain Number - Region: 5-74
Classification Level Classification E-value
Superfamily Hyaluronidase post-catalytic domain-like 0.0173
Family Hyaluronidase post-catalytic domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015138   Gene: ENSRNOG00000042536   Transcript: ENSRNOT00000015138
Sequence length 247
Comment pep:known chromosome:RGSC3.4:2:41275254:41311012:1 gene:ENSRNOG00000042536 transcript:ENSRNOT00000015138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVS
EYISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSCIPRFGVKTEQ
EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMT
LEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVS
NQFLINT
Download sequence
Identical sequences 10116.ENSRNOP00000015138 ENSRNOP00000015138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]